PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.3G366600.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 413aa    MW: 43688.4 Da    PI: 6.7914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.3G366600.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.63.8e-152572148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        +g W++eEde+lv +  + G g+W+ +ar  g+ R++k+c++rw +yl
  Sevir.3G366600.1.p 25 KGLWSPEEDEKLVAYMLRSGQGSWSDVARNAGLQRCGKSCRLRWINYL 72
                        678*******************************************97 PP

2Myb_DNA-binding50.45.1e-1678121146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         rg+++++E++l+v +++ lG++ W+ Ia++++ gRt++++k++w++
  Sevir.3G366600.1.p  78 RGAFSPQEEDLIVSLHAILGNR-WSQIAARLP-GRTDNEIKNFWNS 121
                         89********************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.0272072IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.0E-222175IPR009057Homeodomain-like
SuperFamilySSF466892.07E-2823119IPR009057Homeodomain-like
SMARTSM007178.7E-112474IPR001005SANT/Myb domain
PfamPF002492.9E-132572IPR001005SANT/Myb domain
CDDcd001673.69E-92872No hitNo description
PROSITE profilePS5129424.86773127IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2576128IPR009057Homeodomain-like
SMARTSM007172.4E-1577125IPR001005SANT/Myb domain
PfamPF002491.1E-1478121IPR001005SANT/Myb domain
CDDcd001676.99E-1180120No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050832Biological Processdefense response to fungus
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 413 aa     Download sequence    Send to blast
MRKPEGPAAS GGCNGGAAAA AKLRKGLWSP EEDEKLVAYM LRSGQGSWSD VARNAGLQRC  60
GKSCRLRWIN YLRPDLKRGA FSPQEEDLIV SLHAILGNRW SQIAARLPGR TDNEIKNFWN  120
STIKKRLKNS SSASSPAATD CASPTEPSSK VAGIDISGAT SCPDLASLDH HHQDGGHHHA  180
MMTTGLWMVD SSSSTSSSTS PMQSRPPPSA IAAAVARSYG GLLPLPDQLR GGTAADTSPA  240
GFFHGHAAPF KQQAAVASLH GGYYGMSSPH HHGMMAMEGG GGCFMRGEGL FGVAPLLDAM  300
SAQDQDQAGQ ALIASSGGNN NPKNNSSNNT TETTTTVSNN ESNITDNNTT NTKDNNINAM  360
SLVNSGSSNV AAVYWEGAHQ QYMSRNVMHG EWDLEELMKD VSSLPFLDFQ VE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-28231275108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00599PBMTransfer from AT5G12870Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0750940.0KT075094.1 Panicum virgatum secondary wall-associated MYB domain-containing protein (MYB46A) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004962886.10.0PREDICTED: myb-related protein 330
TrEMBLK3ZDZ40.0K3ZDZ4_SETIT; Uncharacterized protein
STRINGSi024786m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP98213545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12870.14e-67myb domain protein 46